GenicBio Limited
Catalogue Products
Custom Services
GenicBio

Product Information:

Name:Beta-Amyloid 1-40, HFIP

Cat No:HA-40-T-1

Size:5mg

Purity:>95%

Price(USD):

Details


 

Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

                     Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu

                     -Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val

Molecular Weight: 4329.9

Counter Ion: TFA

Appearance: White lyophilized powder

Storage: -20C


Copyright © 2006-2016 GenicBio Limited. All Rights Reserved