GenicBio Limited
Catalogue Products
Custom Services
GenicBio

Product Information:

Name:Beta-Amyloid 1-42, Scrambled

Cat No:A-42-S-1

Size:5mg

Purity:>95%

Price(USD):

Details

Sequence: AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA

                Ala-Ile-Ala-Glu-Gly-Asp-Ser-His-Val-Leu-Lys-Glu-Gly-Ala-Tyr-Met-Glu-Ile-Phe-Asp-Val-Gln-Gly-His-Val-Phe-Gly-Gly-Lys-Ile-Phe-Arg-Val-Val-Asp-Leu-Gly-Ser-His-Asn-Val-Ala


Molecular Weight: 4514.14

Counter Ion: TFA

Appearance: White lyophilized powder

Storage: -20C 


Copyright © 2006-2016 GenicBio Limited. All Rights Reserved